PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g006020.2.1
Common NameLOC101256693
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 303aa    MW: 34863.8 Da    PI: 9.4857
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g006020.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.3e-54101431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL +k+++ +++  ++i++vd++k+ePwdLp k+k + kewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke
  Solyc08g006020.2.1  10 LPPGFRFHPTDEELITYYLVNKINDANFTG-RAIADVDLNKSEPWDLPGKAKMGGKEWYFFSLRDRKYPTGVRTNRATNSGYWKTTGKDKE 99 
                         79*************************999.89***************999999************************************* PP

                 NAM  92 vlsk..kgel.......vglkktLvfykgrapkgektdWvmheyrl 128
                         ++++  +  +       +g+kktLvfykgrap+gek++Wvmheyr+
  Solyc08g006020.2.1 100 IFNSknN--NnnnnlelIGMKKTLVFYKGRAPRGEKSNWVMHEYRI 143
                         ***8551..34556677***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-635165IPR003441NAC domain
PROSITE profilePS5100559.99910165IPR003441NAC domain
PfamPF023655.2E-2911143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MEEVKEETQL PPGFRFHPTD EELITYYLVN KINDANFTGR AIADVDLNKS EPWDLPGKAK  60
MGGKEWYFFS LRDRKYPTGV RTNRATNSGY WKTTGKDKEI FNSKNNNNNN NLELIGMKKT  120
LVFYKGRAPR GEKSNWVMHE YRIRSKSSYK TNKQDEWVVC RIFQKSVGLK KYPTSQYSRA  180
TYSLNNTQNN ASIMSSQMMQ LPNDHQGFQL AMGRNNNNNN NYMNNHGHEI QDVNNRVIFQ  240
SGSSSMINNF PTQPQMSYNI TSYGGEMNNA NTSYGGEMNN ANTMNSGVMD HCVDLHNYWT  300
TY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-5411716171NAC domain-containing protein 19
4dul_A1e-5411716171NAC domain-containing protein 19
1ut7_B1e-5411716171NO APICAL MERISTEM PROTEIN
1ut7_A1e-5411716171NO APICAL MERISTEM PROTEIN
1ut4_B1e-5411716171NO APICAL MERISTEM PROTEIN
1ut4_A1e-5411716171NO APICAL MERISTEM PROTEIN
3swp_D1e-5411719174NAC domain-containing protein 19
3swp_C1e-5411719174NAC domain-containing protein 19
3swp_B1e-5411719174NAC domain-containing protein 19
3swp_A1e-5411719174NAC domain-containing protein 19
3swm_D1e-5411719174NAC domain-containing protein 19
3swm_C1e-5411719174NAC domain-containing protein 19
3swm_B1e-5411719174NAC domain-containing protein 19
3swm_A1e-5411719174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0093570.0Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0025I17, complete sequence
GenBankAP0094830.0Solanum lycopersicum DNA, chromosome 8, clone: C08SLm0116H03, complete sequence
GenBankAP0107840.0Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0021H05, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244460.10.0PREDICTED: NAC domain-containing protein 100-like isoform X1
SwissprotO040178e-81NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLK4CI910.0K4CI91_SOLLC; Uncharacterized protein
STRINGSolyc08g006020.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-105NAC domain containing protein 38
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]